PCBD2 Blocking Peptide (33R-10370)

A synthetic peptide for use as a blocking control in assays to test for specificity of PCBD2 antibody, catalog no. 70R-10088

Synonyms PCBD2 control peptide, PCBD2 antibody Blocking Peptide, Anti-PCBD2 Blocking Peptide, pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha, TCF1 2 Blocking Peptide, DCOH2 Blocking Peptide, DCOHM Blocking Peptide, PHS2 Blocking Peptide, PCBD2, PCBD-2, PCBD 2, PCBD-2 Blocking Peptide, PCBD 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLA
Molecular Weight 14 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCBD2 is involved in tetrahydrobiopterin biosynthesis. It seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors