PCBP1 antibody (70R-1466)

Rabbit polyclonal PCBP1 antibody

Synonyms Polyclonal PCBP1 antibody, Anti-PCBP1 antibody, PCBP-1 antibody, PCBP 1, Poly rC binding protein 1 antibody, PCBP1, PCBP 1 antibody, PCBP-1
Cross Reactivity Human
Applications WB
Immunogen PCBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM
Assay Information PCBP1 Blocking Peptide, catalog no. 33R-1804, is also available for use as a blocking control in assays to test for specificity of this PCBP1 antibody


Western Blot analysis using PCBP1 antibody (70R-1466)

PCBP1 antibody (70R-1466) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PCBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCBP1 appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human Papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PCBP1 antibody (70R-1466) | PCBP1 antibody (70R-1466) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors