PCBP1 antibody (70R-4995)

Rabbit polyclonal PCBP1 antibody

Synonyms Polyclonal PCBP1 antibody, Anti-PCBP1 antibody, PCBP 1 antibody, Poly rC binding protein 1 antibody, PCBP1, PCBP-1 antibody, hnRNP-E1 antibody, HNRPE1 antibody, PCBP-1, PCBP 1, HNRPX antibody, hnRNP-X antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PCBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF
Assay Information PCBP1 Blocking Peptide, catalog no. 33R-7142, is also available for use as a blocking control in assays to test for specificity of this PCBP1 antibody


Immunohistochemical staining using PCBP1 antibody (70R-4995)

PCBP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCBP1 appears to be multifunctional. It along with PCBP-2 and hnRNPK corresponds to the major cellular poly(rC)-binding protein. It contains three K-homologous (KH) domains which may be involved in RNA binding. This protein together with PCBP-2 also functions as translational coactivators of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES and promote poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using PCBP1 antibody (70R-4995) | PCBP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using PCBP1 antibody (70R-4995) | PCBP1 antibody (70R-4995) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors