PCBP3 antibody (70R-4780)

Rabbit polyclonal PCBP3 antibody

Synonyms Polyclonal PCBP3 antibody, Anti-PCBP3 antibody, PCBP-3 antibody, Poly rC binding protein 3 antibody, PCBP 3 antibody, PCBP-3, PCBP3, ALPHA-CP3 antibody, PCBP 3
Cross Reactivity Human,Mouse
Applications WB
Immunogen PCBP3 antibody was raised using a synthetic peptide corresponding to a region with amino acids QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI
Assay Information PCBP3 Blocking Peptide, catalog no. 33R-7759, is also available for use as a blocking control in assays to test for specificity of this PCBP3 antibody


Western Blot analysis using PCBP3 antibody (70R-4780)

PCBP3 antibody (70R-4780) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCBP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PCBP3 antibody (70R-4780) | PCBP3 antibody (70R-4780) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors