PCBP4 antibody (70R-1627)

Rabbit polyclonal PCBP4 antibody

Synonyms Polyclonal PCBP4 antibody, Anti-PCBP4 antibody, PCBP 4, Poly rC binding protein 4 antibody, PCBP-4 antibody, PCBP 4 antibody, PCBP-4, PCBP4
Cross Reactivity Human
Applications WB
Immunogen PCBP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVP
Assay Information PCBP4 Blocking Peptide, catalog no. 33R-8924, is also available for use as a blocking control in assays to test for specificity of this PCBP4 antibody


Western Blot analysis using PCBP4 antibody (70R-1627)

PCBP4 antibody (70R-1627) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PCBP4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCBP4 is a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and have different cellular distributions. This gene is induced by the p53 tumor suppressor, and the protein can suppress cell proliferation by inducing apoptosis and cell cycle arrest in G(2)-M.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PCBP4 antibody (70R-1627) | PCBP4 antibody (70R-1627) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors