PCCA antibody (70R-2509)

Rabbit polyclonal PCCA antibody raised against the N terminal of PCCA

Synonyms Polyclonal PCCA antibody, Anti-PCCA antibody, Propionyl Coenzyme A Carboxylase Alpha Polypeptide antibody
Specificity PCCA antibody was raised against the N terminal of PCCA
Cross Reactivity Human
Applications WB
Immunogen PCCA antibody was raised using the N terminal of PCCA corresponding to a region with amino acids LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI
Assay Information PCCA Blocking Peptide, catalog no. 33R-5579, is also available for use as a blocking control in assays to test for specificity of this PCCA antibody


Western Blot analysis using PCCA antibody (70R-2509)

PCCA antibody (70R-2509) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 75 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCCA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCCA is the alpha subunit of the heterodimeric mitochondrial enzyme Propionyl-CoA carboxylase. PCCA is the biotin-binding region of this enzyme. Mutations in either PCCA or PCCB (encoding the beta subunit) lead to an enzyme deficiency resulting in propionic acidemia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PCCA antibody (70R-2509) | PCCA antibody (70R-2509) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors