PCDH17 antibody (70R-2580)

Rabbit polyclonal PCDH17 antibody raised against the C terminal of PCDH17

Synonyms Polyclonal PCDH17 antibody, Anti-PCDH17 antibody, PCDH 17 antibody, Protocadherin 17 antibody, PCDH17, PCDH68 antibody, PCDH-17, PCDH 17, PCH68 antibody, PCDH-17 antibody
Specificity PCDH17 antibody was raised against the C terminal of PCDH17
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PCDH17 antibody was raised using the C terminal of PCDH17 corresponding to a region with amino acids SEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK
Assay Information PCDH17 Blocking Peptide, catalog no. 33R-8394, is also available for use as a blocking control in assays to test for specificity of this PCDH17 antibody


Western Blot analysis using PCDH17 antibody (70R-2580)

PCDH17 antibody (70R-2580) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 124 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCDH17 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCDH17 contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins.It may play a role in the establishment and function of specific cell-cell connections in the brain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PCDH17 antibody (70R-2580) | PCDH17 antibody (70R-2580) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors