PCMT1 antibody (70R-1558)

Rabbit polyclonal PCMT1 antibody

Synonyms Polyclonal PCMT1 antibody, Anti-PCMT1 antibody, PCMT-1, PCMT 1, Protein-L-Isoaspartate antibody, D-Aspartate O-Methyltransferase antibody, PCMT-1 antibody, PCMT1, PCMT 1 antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen PCMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids APYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQD
Assay Information PCMT1 Blocking Peptide, catalog no. 33R-1442, is also available for use as a blocking control in assays to test for specificity of this PCMT1 antibody

Images

Western Blot analysis using PCMT1 antibody (70R-1558)

PCMT1 antibody (70R-1558) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PCMT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Three classes of protein carboxyl methyltransferases, distinguished by their methyl-acceptor substrate specificity, have been found in prokaryotic and eukaryotic cells. The type II enzyme catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to the free carboxyl groups of D-aspartyl and L-isoaspartyl residues. These methyl-accepting residues result from the spontaneous deamidation, isomerization, and racemization of normal L-aspartyl and L-asparaginyl residues and represent sites of covalent damage to aging proteins PCMT1 (EC 2.1.1.77) is a protein repair enzyme that initiates the conversion of abnormal D-aspartyl and L-isoaspartyl residues to the normal L-aspartyl form.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PCMT1 antibody (70R-1558) | PCMT1 antibody (70R-1558) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors