PCOLCE antibody (70R-5478)

Rabbit polyclonal PCOLCE antibody raised against the middle region of PCOLCE

Synonyms Polyclonal PCOLCE antibody, Anti-PCOLCE antibody, PCPE antibody, PCPE1 antibody, Procollagen C-Endopeptidase Enhancer antibody
Specificity PCOLCE antibody was raised against the middle region of PCOLCE
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PCOLCE antibody was raised using the middle region of PCOLCE corresponding to a region with amino acids LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS
Assay Information PCOLCE Blocking Peptide, catalog no. 33R-5197, is also available for use as a blocking control in assays to test for specificity of this PCOLCE antibody


Western Blot analysis using PCOLCE antibody (70R-5478)

PCOLCE antibody (70R-5478) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PCOLCE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PCOLCE antibody (70R-5478) | PCOLCE antibody (70R-5478) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €309.90
Size: 50 ug
View Our Distributors