PCSK2 Blocking Peptide (33R-4799)

A synthetic peptide for use as a blocking control in assays to test for specificity of PCSK2 antibody, catalog no. 70R-9811

Synonyms PCSK2 control peptide, PCSK2 antibody Blocking Peptide, Anti-PCSK2 Blocking Peptide, proprotein convertase subtilisin/kexin type 2 Blocking Peptide, NEC2 Blocking Peptide, PC2 Blocking Peptide, SPC2 Blocking Peptide, PCSK2, PCSK-2, PCSK 2, PCSK-2 Blocking Peptide, PCSK 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEA
Molecular Weight 58 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the subtilisin-like proprotein convertase family. These enzymes process latent precursor proteins into their biologically active products. The encoded protein plays a critical role in hormone biosynthesis by processing a variety of prohormones including proinsulin, proopiomelanocortin and proluteinizing-hormone-releasing hormone. Single nucleotide polymorphisms in this gene may increase susceptibility to myocardial infarction and type 2 diabetes. This gene may also play a role in tumor development and progression. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors