PCSK2 Blocking Peptide (33R-4799)
A synthetic peptide for use as a blocking control in assays to test for specificity of PCSK2 antibody, catalog no. 70R-9811
Overview
Overview
| Synonyms | PCSK2 control peptide, PCSK2 antibody Blocking Peptide, Anti-PCSK2 Blocking Peptide, proprotein convertase subtilisin/kexin type 2 Blocking Peptide, NEC2 Blocking Peptide, PC2 Blocking Peptide, SPC2 Blocking Peptide, PCSK2, PCSK-2, PCSK 2, PCSK-2 Blocking Peptide, PCSK 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | LASTFSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEA |
|---|---|
| Molecular Weight | 58 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a member of the subtilisin-like proprotein convertase family. These enzymes process latent precursor proteins into their biologically active products. The encoded protein plays a critical role in hormone biosynthesis by processing a variety of prohormones including proinsulin, proopiomelanocortin and proluteinizing-hormone-releasing hormone. Single nucleotide polymorphisms in this gene may increase susceptibility to myocardial infarction and type 2 diabetes. This gene may also play a role in tumor development and progression. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product