PCYT2 antibody (70R-1192)

Rabbit polyclonal PCYT2 antibody raised against the C terminal of PCYT2

Synonyms Polyclonal PCYT2 antibody, Anti-PCYT2 antibody, PCYT2, PCYT 2, PCYT-2, ET antibody, Phosphate Cytidylyltransferase 2 Ethanolamine antibody, PCYT 2 antibody, PCYT-2 antibody
Specificity PCYT2 antibody was raised against the C terminal of PCYT2
Cross Reactivity Human,Mouse
Applications WB
Immunogen PCYT2 antibody was raised using the C terminal of PCYT2 corresponding to a region with amino acids KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII
Assay Information PCYT2 Blocking Peptide, catalog no. 33R-4702, is also available for use as a blocking control in assays to test for specificity of this PCYT2 antibody


Western Blot analysis using PCYT2 antibody (70R-1192)

PCYT2 antibody (70R-1192) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PCYT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PCYT2 is an enzyme that catalyzes the formation of CDP-ethanolamine from CTP and phosphoethanolamine in the Kennedy pathway of phospholipid synthesis. Alternative splicing results in multiple transcript variants.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PCYT2 antibody (70R-1192) | PCYT2 antibody (70R-1192) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors