PDE1C antibody (70R-2073)

Rabbit polyclonal PDE1C antibody raised against the middle region of PDE1C

Synonyms Polyclonal PDE1C antibody, Anti-PDE1C antibody, Phosphodiesterase 1C Calmodulin-Dependent 70Kda antibody, PDE1C, Hcam3 antibody, PDEC 1, PDEC-1 antibody, PDEC-1, PDEC 1 antibody
Specificity PDE1C antibody was raised against the middle region of PDE1C
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen PDE1C antibody was raised using the middle region of PDE1C corresponding to a region with amino acids IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR
Assay Information PDE1C Blocking Peptide, catalog no. 33R-3912, is also available for use as a blocking control in assays to test for specificity of this PDE1C antibody

Images

Western Blot analysis using PDE1C antibody (70R-2073)

PDE1C antibody (70R-2073) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDE1C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis of the cyclic nucleotides cAMP and cGMP to the corresponding nucleoside 5-prime-monophosphates. Mammalian PDEs have been classified into several families based on their biochemical properties

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PDE1C antibody (70R-2073) | PDE1C antibody (70R-2073) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors