PDE1C antibody (70R-2390)

Rabbit polyclonal PDE1C antibody raised against the N terminal of PDE1C

Synonyms Polyclonal PDE1C antibody, Anti-PDE1C antibody, PDE1C, MGC26303 antibody, Phosphodiesterase 1C Calmodulin-Dependent 70Kda antibody, HCAM1 antibody, PDEC 1 antibody, PDEC 1, PDEC-1 antibody, HSPDE1A antibody, PDEC-1
Specificity PDE1C antibody was raised against the N terminal of PDE1C
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PDE1C antibody was raised using the N terminal of PDE1C corresponding to a region with amino acids DLKKNIEYAASVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLAST
Assay Information PDE1C Blocking Peptide, catalog no. 33R-2051, is also available for use as a blocking control in assays to test for specificity of this PDE1C antibody


Western Blot analysis using PDE1C antibody (70R-2390)

PDE1C antibody (70R-2390) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDE1C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PDE1A belongs to the cyclic nucleotide phosphodiesterase family. It has a higher affinity for cGMP than for cAMP. The exact function of PDE1A remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PDE1C antibody (70R-2390) | PDE1C antibody (70R-2390) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors