PDIA6 antibody (70R-5406)

Rabbit polyclonal PDIA6 antibody raised against the middle region of PDIA6

Synonyms Polyclonal PDIA6 antibody, Anti-PDIA6 antibody, Protein Disulfide Isomerase Family A Member 6 antibody, PDIA-6 antibody, PDIA-6, ERP5 antibody, PDIA6, P5 antibody, PDIA 6, PDIA 6 antibody, TXNDC7 antibody
Specificity PDIA6 antibody was raised against the middle region of PDIA6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PDIA6 antibody was raised using the middle region of PDIA6 corresponding to a region with amino acids KLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRA
Assay Information PDIA6 Blocking Peptide, catalog no. 33R-4499, is also available for use as a blocking control in assays to test for specificity of this PDIA6 antibody


Western Blot analysis using PDIA6 antibody (70R-5406)

PDIA6 antibody (70R-5406) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDIA6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Protein disulfide isomerases, such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PDIA6 antibody (70R-5406) | PDIA6 antibody (70R-5406) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors