PDIK1L antibody (70R-4177)

Rabbit polyclonal PDIK1L antibody raised against the middle region of PDIK1L

Synonyms Polyclonal PDIK1L antibody, Anti-PDIK1L antibody, PDIKL-1 antibody, PDIK1L, PDIKL 1, PDIKL-1, RP11-96L14.4 antibody, PDIKL 1 antibody, CLIK1L antibody, Pdlim1 Interacting Kinase 1 Like antibody
Specificity PDIK1L antibody was raised against the middle region of PDIK1L
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PDIK1L antibody was raised using the middle region of PDIK1L corresponding to a region with amino acids FDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNRKTNTSFMLQLSSALAFLH
Assay Information PDIK1L Blocking Peptide, catalog no. 33R-2870, is also available for use as a blocking control in assays to test for specificity of this PDIK1L antibody

Images

Western Blot analysis using PDIK1L antibody (70R-4177)

PDIK1L antibody (70R-4177) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDIK1L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of PDIK1L is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PDIK1L antibody (70R-4177) | PDIK1L antibody (70R-4177) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors