PDIK1L antibody (70R-4178)

Rabbit polyclonal PDIK1L antibody raised against the middle region of PDIK1L

Synonyms Polyclonal PDIK1L antibody, Anti-PDIK1L antibody, Pdlim1 Interacting Kinase 1 Like antibody, PDIKL 1 antibody, CLIK1L antibody, PDIKL-1, PDIKL 1, PDIKL-1 antibody, RP11-96L14.4 antibody, PDIK1L
Specificity PDIK1L antibody was raised against the middle region of PDIK1L
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PDIK1L antibody was raised using the middle region of PDIK1L corresponding to a region with amino acids TSDLEPTLKVADFGLSKVCSASGQNPEEPVSVNKCFLSTACGTDFYMAPE
Assay Information PDIK1L Blocking Peptide, catalog no. 33R-9279, is also available for use as a blocking control in assays to test for specificity of this PDIK1L antibody


Western Blot analysis using PDIK1L antibody (70R-4178)

PDIK1L antibody (70R-4178) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDIK1L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of PDIK1L is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PDIK1L antibody (70R-4178) | PDIK1L antibody (70R-4178) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors