PDIK1L Blocking Peptide (33R-9279)
A synthetic peptide for use as a blocking control in assays to test for specificity of PDIK1L antibody, catalog no. 70R-4178
Overview
Overview
| Synonyms | PDIK1L control peptide, PDIK1L antibody Blocking Peptide, Anti-PDIK1L Blocking Peptide, Pdlim1 Interacting Kinase 1 Like Blocking Peptide, CLIK1L Blocking Peptide, RP11-96L14.4 Blocking Peptide, PDIK1L, PDIKL-1, PDIKL 1, PDIKL-1 Blocking Peptide, PDIKL 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TSDLEPTLKVADFGLSKVCSASGQNPEEPVSVNKCFLSTACGTDFYMAPE |
|---|---|
| Molecular Weight | 38 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The specific function of PDIK1L is not yet known. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product