PDIK1L Blocking Peptide (33R-9279)

A synthetic peptide for use as a blocking control in assays to test for specificity of PDIK1L antibody, catalog no. 70R-4178

Synonyms PDIK1L control peptide, PDIK1L antibody Blocking Peptide, Anti-PDIK1L Blocking Peptide, Pdlim1 Interacting Kinase 1 Like Blocking Peptide, CLIK1L Blocking Peptide, RP11-96L14.4 Blocking Peptide, PDIK1L, PDIKL-1, PDIKL 1, PDIKL-1 Blocking Peptide, PDIKL 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TSDLEPTLKVADFGLSKVCSASGQNPEEPVSVNKCFLSTACGTDFYMAPE
Molecular Weight 38 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of PDIK1L is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors