PDK2 antibody (70R-2454)

Rabbit polyclonal PDK2 antibody raised against the middle region of PDK2

Synonyms Polyclonal PDK2 antibody, Anti-PDK2 antibody, PDK-2, PDK2, PDK 2 antibody, Pyruvate Dehydrogenase Kinase Isozyme 2 antibody, PDK 2, PDK-2 antibody
Specificity PDK2 antibody was raised against the middle region of PDK2
Cross Reactivity Human
Applications WB
Immunogen PDK2 antibody was raised using the middle region of PDK2 corresponding to a region with amino acids ELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI
Assay Information PDK2 Blocking Peptide, catalog no. 33R-2541, is also available for use as a blocking control in assays to test for specificity of this PDK2 antibody


Western blot analysis using PDK2 antibody (70R-2454)

Recommended PDK2 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDK2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PDK2 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using PDK2 antibody (70R-2454) | Recommended PDK2 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using PDK2 antibody (70R-2454) | Heart cell lysates

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors