PDK3 antibody (70R-2460)

Rabbit polyclonal PDK3 antibody raised against the middle region of PDK3

Synonyms Polyclonal PDK3 antibody, Anti-PDK3 antibody, PDK-3, PDK 3, PDK-3 antibody, PDK 3 antibody, PDK3, Pyruvate Dehydrogenase Kinase Isozyme 3 antibody
Specificity PDK3 antibody was raised against the middle region of PDK3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PDK3 antibody was raised using the middle region of PDK3 corresponding to a region with amino acids IYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAK
Assay Information PDK3 Blocking Peptide, catalog no. 33R-4222, is also available for use as a blocking control in assays to test for specificity of this PDK3 antibody


Western Blot analysis using PDK3 antibody (70R-2460)

PDK3 antibody (70R-2460) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDK3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PDK3 belongs to the PDK/BCkDaK protein kinase family. It contains 1 histidine kinase domain. PDK3 inhibits the mitochondrial pyruvate dehydrogenase complex by phosphorylation of the E1 alpha subunit, thus contributing to the regulation of glucose metabolism.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PDK3 antibody (70R-2460) | PDK3 antibody (70R-2460) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors