PDP2 antibody (70R-3847)

Rabbit polyclonal PDP2 antibody raised against the middle region of PDP2

Synonyms Polyclonal PDP2 antibody, Anti-PDP2 antibody, Pyruvate Dehyrogenase Phosphatase Catalytic Subunit 2 antibody, KIAA1348 antibody, PDP-2, PDP-2 antibody, PDP 2 antibody, PDP 2, PDP2
Specificity PDP2 antibody was raised against the middle region of PDP2
Cross Reactivity Human
Applications WB
Immunogen PDP2 antibody was raised using the middle region of PDP2 corresponding to a region with amino acids LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLV
Assay Information PDP2 Blocking Peptide, catalog no. 33R-5337, is also available for use as a blocking control in assays to test for specificity of this PDP2 antibody

Images

Western Blot analysis using PDP2 antibody (70R-3847)

PDP2 antibody (70R-3847) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PDP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PDP2 catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PDP2 antibody (70R-3847) | PDP2 antibody (70R-3847) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors