PDSS1 antibody (70R-1089)

Rabbit polyclonal PDSS1 antibody

Synonyms Polyclonal PDSS1 antibody, Anti-PDSS1 antibody, TPT antibody, Prenyl decaprenyl diphosphate synthase subunit 1 antibody, TPRT antibody, COQ1 antibody, PDSS 1 antibody, PDSS 1, PDSS-1 antibody, hDPS1 antibody, MGC70953 antibody, PDSS-1, PDSS1, Decaprenyl Diphosphate Synthase Subunit 1 antibody, RP13-16H11.3 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen PDSS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHE
Assay Information PDSS1 Blocking Peptide, catalog no. 33R-3225, is also available for use as a blocking control in assays to test for specificity of this PDSS1 antibody

Western Blot analysis using PDSS1 antibody (70R-1089)

PDSS1 antibody (70R-1089) used at 5 ug/ml to detect target protein.

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PDSS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PDSS1 is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. PDSS1 catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in PDSS1 gene are a cause of coenzyme Q10 deficiency.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using PDSS1 antibody (70R-1089) | PDSS1 antibody (70R-1089) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors