PELI3 antibody (70R-3351)

Rabbit polyclonal PELI3 antibody

Synonyms Polyclonal PELI3 antibody, Anti-PELI3 antibody, MGC35521 antibody, PELI 3 antibody, PELI 3, Pellino Homolog 3 antibody, PELI-3, PELI3, PELI-3 antibody
Cross Reactivity Human
Applications WB
Immunogen PELI3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLG
Assay Information PELI3 Blocking Peptide, catalog no. 33R-9650, is also available for use as a blocking control in assays to test for specificity of this PELI3 antibody


Western Blot analysis using PELI3 antibody (70R-3351)

PELI3 antibody (70R-3351) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PELI3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Toll-like receptors (TLRs) and IL1R (IL1R1) are part of the innate immune response aimed at mobilizing defense mechanisms in response in infection or injury. Pellino proteins, such as PELI3, are intermediate components in the signaling cascades initiated by TLRs and IL1R.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PELI3 antibody (70R-3351) | PELI3 antibody (70R-3351) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors