Peptidase D antibody (70R-4294)

Rabbit polyclonal Peptidase D antibody raised against the middle region of PEPD

Synonyms Polyclonal Peptidase D antibody, Anti-Peptidase D antibody, MGC10905 antibody, PEPD antibody, PROLIDASE antibody
Specificity Peptidase D antibody was raised against the middle region of PEPD
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Peptidase D antibody was raised using the middle region of PEPD corresponding to a region with amino acids LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV
Assay Information Peptidase D Blocking Peptide, catalog no. 33R-4964, is also available for use as a blocking control in assays to test for specificity of this Peptidase D antibody


Western Blot analysis using Peptidase D antibody (70R-4294)

Peptidase D antibody (70R-4294) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PEPD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Xaa-Pro dipeptidase is a cytosolic dipeptidase that hydrolyzes dipeptides with proline or hydroxyproline at the carboxy terminus (but not Pro-Pro). It is important in collagen metabolism because of the high levels of iminoacids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Peptidase D antibody (70R-4294) | Peptidase D antibody (70R-4294) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors