Perilipin antibody (70R-1297)

Rabbit polyclonal Perilipin antibody raised against the N terminal of PLIN

Synonyms Polyclonal Perilipin antibody, Anti-Perilipin antibody, PERI antibody, PLIN antibody
Specificity Perilipin antibody was raised against the N terminal of PLIN
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen Perilipin antibody was raised using the N terminal of PLIN corresponding to a region with amino acids STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS
Assay Information Perilipin Blocking Peptide, catalog no. 33R-8885, is also available for use as a blocking control in assays to test for specificity of this Perilipin antibody


Western Blot analysis using Perilipin antibody (70R-1297)

Perilipin antibody (70R-1297) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PLIN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PLIN coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Perilipin antibody (70R-1297) | Perilipin antibody (70R-1297) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors