Perilipin antibody (70R-1297)
Rabbit polyclonal Perilipin antibody raised against the N terminal of PLIN
Overview
Overview
| Synonyms | Polyclonal Perilipin antibody, Anti-Perilipin antibody, PERI antibody, PLIN antibody |
|---|---|
| Specificity | Perilipin antibody was raised against the N terminal of PLIN |
| Cross Reactivity | Human,Mouse,Rat,Dog |
| Applications | WB |
| Immunogen | Perilipin antibody was raised using the N terminal of PLIN corresponding to a region with amino acids STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS |
| Assay Information | Perilipin Blocking Peptide, catalog no. 33R-8885, is also available for use as a blocking control in assays to test for specificity of this Perilipin antibody |
Images
Western Blot analysis using Perilipin antibody (70R-1297)
Perilipin antibody (70R-1297) used at 1.25 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Total IgG Protein A purified |
| Molecular Weight | 57 kDa (MW of target protein) |
| Form & Buffer | Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 1.25 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PLIN coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product