Perilipin Blocking Peptide (33R-8885)
A synthetic peptide for use as a blocking control in assays to test for specificity of PLIN antibody, catalog no. 70R-1297
Overview
Overview
| Synonyms | Perilipin control peptide, Perilipin antibody Blocking Peptide, Anti-Perilipin Blocking Peptide, PERI Blocking Peptide, PLIN Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS |
|---|---|
| Molecular Weight | 57 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PLIN coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product