Perilipin Blocking Peptide (33R-8885)

A synthetic peptide for use as a blocking control in assays to test for specificity of PLIN antibody, catalog no. 70R-1297

Synonyms Perilipin control peptide, Perilipin antibody Blocking Peptide, Anti-Perilipin Blocking Peptide, PERI Blocking Peptide, PLIN Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS
Molecular Weight 57 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PLIN coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors