Periplakin antibody (70R-2652)

Rabbit polyclonal Periplakin antibody raised against the middle region of PPL

Synonyms Polyclonal Periplakin antibody, Anti-Periplakin antibody, PPL antibody, MGC134872 antibody, KIAA0568 antibody
Specificity Periplakin antibody was raised against the middle region of PPL
Cross Reactivity Human
Applications WB
Immunogen Periplakin antibody was raised using the middle region of PPL corresponding to a region with amino acids EKSRAQEKVTEKEVVKLQNDPQLEAEYQQLQEDHQRQDQLREKQEEELSF
Assay Information Periplakin Blocking Peptide, catalog no. 33R-2523, is also available for use as a blocking control in assays to test for specificity of this Periplakin antibody


Western Blot analysis using Periplakin antibody (70R-2652)

Periplakin antibody (70R-2652) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 205 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PPL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PPL is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Periplakin antibody (70R-2652) | Periplakin antibody (70R-2652) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors