PES1 antibody (70R-3107)

Rabbit polyclonal PES1 antibody

Synonyms Polyclonal PES1 antibody, Anti-PES1 antibody, PES antibody, Pescadillo Homolog 1 Containing Brct Domain antibody, PES 1, PES-1 antibody, PES-1, PES 1 antibody, PES1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PES1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKREKYLYQKIMFGKRRKIREANKLAEKRKAHDEAVRSEKKAKKARPE
Assay Information PES1 Blocking Peptide, catalog no. 33R-4489, is also available for use as a blocking control in assays to test for specificity of this PES1 antibody


Western Blot analysis using PES1 antibody (70R-3107)

PES1 antibody (70R-3107) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PES1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PES1 is abnormally elevated in malignant tumors of astrocytic origin. It is a strongly conserved gene containing a BRCT domain that is essential for the activity of this gene product. The gene plays a crucial role in cell proliferation and may be necessary for oncogenic transformation and tumor progression.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PES1 antibody (70R-3107) | PES1 antibody (70R-3107) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors