PFAS antibody (70R-2690)

Rabbit polyclonal PFAS antibody

Synonyms Polyclonal PFAS antibody, Anti-PFAS antibody, FGAMS antibody, PURL antibody, Fgar Amidotransferase antibody, KIAA0361 antibody, Phosphoribosylformylglycinamidine Synthase antibody, FGARAT antibody
Cross Reactivity Human
Applications WB
Immunogen PFAS antibody was raised using a synthetic peptide corresponding to a region with amino acids ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL
Assay Information PFAS Blocking Peptide, catalog no. 33R-2731, is also available for use as a blocking control in assays to test for specificity of this PFAS antibody


Western Blot analysis using PFAS antibody (70R-2690)

PFAS antibody (70R-2690) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 145 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PFAS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. PFAS catalyzes the fourth step of IMP biosynthesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PFAS antibody (70R-2690) | PFAS antibody (70R-2690) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors