PFKL antibody (70R-1248)

Rabbit polyclonal PFKL antibody raised against the middle region of PFKL

Synonyms Polyclonal PFKL antibody, Anti-PFKL antibody, Phosphofructokinase Liver antibody, FLJ40909 antibody, DKFZp686L2097 antibody, DKFZp686G1648 antibody, PFK-B antibody, FLJ30173 antibody
Specificity PFKL antibody was raised against the middle region of PFKL
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen PFKL antibody was raised using the middle region of PFKL corresponding to a region with amino acids RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA
Assay Information PFKL Blocking Peptide, catalog no. 33R-8233, is also available for use as a blocking control in assays to test for specificity of this PFKL antibody


Western Blot analysis using PFKL antibody (70R-1248)

PFKL antibody (70R-1248) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PFKL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Phosphofructokinase (PFK) is a tetrameric enzyme that catalyzes a key step in glycolysis, namely the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate. PFK from muscle is a homotetramer of M subunit, PFK from liver is a homotetramer of L-subunits, while PFK from platelets can be composed of any tetrameric combination of M and L subunits. PFKL represents the L subunit.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PFKL antibody (70R-1248) | PFKL antibody (70R-1248) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors