PGBD2 Blocking Peptide (33R-7960)

A synthetic peptide for use as a blocking control in assays to test for specificity of PGBD2 antibody, catalog no. 70R-4210

Synonyms PGBD2 control peptide, PGBD2 antibody Blocking Peptide, Anti-PGBD2 Blocking Peptide, Piggybac Transposable Element Derived 2 Blocking Peptide, PGBD2, PGBD-2, PGBD 2, PGBD-2 Blocking Peptide, PGBD 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RICCQDAQVDLLAFRRYIACVYLESNADTTSQGRRSRRLETESRFDMIGH
Molecular Weight 39 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors