PGDS antibody (70R-2383)

Rabbit polyclonal PGDS antibody raised against the N terminal of PGDS

Synonyms Polyclonal PGDS antibody, Anti-PGDS antibody, Prostaglandin D2 Synthase Hematopoietic antibody
Specificity PGDS antibody was raised against the N terminal of PGDS
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PGDS antibody was raised using the N terminal of PGDS corresponding to a region with amino acids EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME
Assay Information PGDS Blocking Peptide, catalog no. 33R-2657, is also available for use as a blocking control in assays to test for specificity of this PGDS antibody

Images

Western Blot analysis using PGDS antibody (70R-2383)

PGDS antibody (70R-2383) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PGDS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PGDS is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes. Prostaglandin-D synthase is a sigma class glutathione-S-transferase family member. The enzyme catalyzes the conversion of PGH2 to PGD2 and plays a role in the production of prostanoids in the immune system and mast cells. The presence of this enzyme can be used to identify the differentiation stage of human megakaryocytes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PGDS antibody (70R-2383) | PGDS antibody (70R-2383) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors