PGLS Blocking Peptide (33R-1059)

A synthetic peptide for use as a blocking control in assays to test for specificity of PGLS antibody, catalog no. 70R-3312

Synonyms PGLS control peptide, PGLS antibody Blocking Peptide, Anti-PGLS Blocking Peptide, 6-Phosphogluconolactonase Blocking Peptide, 6PGL Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL
Molecular Weight 28 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PGLS belongs to the glucosamine/galactosamine-6-phosphate isomerase family, 6-phosphogluconolactonase subfamily. It is implicated in the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors