PGLS Blocking Peptide (33R-1059)
A synthetic peptide for use as a blocking control in assays to test for specificity of PGLS antibody, catalog no. 70R-3312
Overview
Overview
| Synonyms | PGLS control peptide, PGLS antibody Blocking Peptide, Anti-PGLS Blocking Peptide, 6-Phosphogluconolactonase Blocking Peptide, 6PGL Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL |
|---|---|
| Molecular Weight | 28 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PGLS belongs to the glucosamine/galactosamine-6-phosphate isomerase family, 6-phosphogluconolactonase subfamily. It is implicated in the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product