PGM3 antibody (70R-4450)

Rabbit polyclonal PGM3 antibody raised against the N terminal of PGM3

Synonyms Polyclonal PGM3 antibody, Anti-PGM3 antibody, DKFZp434B187 antibody, PGM3, PGM 3, PGM-3, PGM-3 antibody, Phosphoglucomutase 3 antibody, PGM 3 antibody, AGM1 antibody, PAGM antibody
Specificity PGM3 antibody was raised against the N terminal of PGM3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PGM3 antibody was raised using the N terminal of PGM3 corresponding to a region with amino acids IDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGL
Assay Information PGM3 Blocking Peptide, catalog no. 33R-3917, is also available for use as a blocking control in assays to test for specificity of this PGM3 antibody


Western Blot analysis using PGM3 antibody (70R-4450)

PGM3 antibody (70R-4450) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PGM3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PGM3 antibody (70R-4450) | PGM3 antibody (70R-4450) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors