PGRMC1 Blocking Peptide (33R-5590)
A synthetic peptide for use as a blocking control in assays to test for specificity of PGRMC1 antibody, catalog no. 70R-6737
Overview
Overview
| Synonyms | PGRMC1 control peptide, PGRMC1 antibody Blocking Peptide, Anti-PGRMC1 Blocking Peptide, Progesterone Receptor Membrane Component 1 Blocking Peptide, HPR6.6 Blocking Peptide, MPR Blocking Peptide, PGRMC1, PGRMC-1, PGRMC 1, PGRMC-1 Blocking Peptide, PGRMC 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQ |
|---|---|
| Molecular Weight | 22 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Progesterone binding protein is a putative steroid membrane receptor. The protein is expressed predominantly in the liver and kidney. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product