PH4 Blocking Peptide (33R-8025)

A synthetic peptide for use as a blocking control in assays to test for specificity of PH-4 antibody, catalog no. 70R-7088

Synonyms PH4 control peptide, PH4 antibody Blocking Peptide, Anti-PH4 Blocking Peptide, PH-4 Blocking Peptide, Hypoxia-Inducible Factor Prolyl 4-Hydroxylase Blocking Peptide, P4H-TM Blocking Peptide, PH4, PH-4, PH 4, PH-4 Blocking Peptide, PH 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH
Molecular Weight 57 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors