PH4 Blocking Peptide (33R-8025)
A synthetic peptide for use as a blocking control in assays to test for specificity of PH-4 antibody, catalog no. 70R-7088
Overview
Overview
| Synonyms | PH4 control peptide, PH4 antibody Blocking Peptide, Anti-PH4 Blocking Peptide, PH-4 Blocking Peptide, Hypoxia-Inducible Factor Prolyl 4-Hydroxylase Blocking Peptide, P4H-TM Blocking Peptide, PH4, PH-4, PH 4, PH-4 Blocking Peptide, PH 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH |
|---|---|
| Molecular Weight | 57 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product