PHF20L1 Blocking Peptide (33R-1031)
A synthetic peptide for use as a blocking control in assays to test for specificity of PHF20L1 antibody, catalog no. 70R-8973
Overview
Overview
| Synonyms | PHF20L1 control peptide, PHF20L1 antibody Blocking Peptide, Anti-PHF20L1 Blocking Peptide, PHD finger protein 20-like 1 Blocking Peptide, CGI-72 Blocking Peptide, MGC64923 Blocking Peptide, PHF20L1, PHFL1-20, PHFL1 20, PHFL1-20 Blocking Peptide, PHFL1 20 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAKNKTGSKPRTSANSNKDKDKDERKWFKVPSKKEETSTCIATPDVEKKE |
|---|---|
| Molecular Weight | 63 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | PHF20L1 is Involved in cell differentiation and/or proliferation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product