Phkg1 Blocking Peptide (33R-7866)
A synthetic peptide for use as a blocking control in assays to test for specificity of Phkg1 antibody, catalog no. 70R-9422
Overview
Overview
| Synonyms | Phkg1 control peptide, Phkg1 antibody Blocking Peptide, Anti-Phkg1 Blocking Peptide, phosphorylase kinase, gamma 1 Blocking Peptide, Phkg Blocking Peptide, PHKIN01 Blocking Peptide, Phkg1 Blocking Peptide, Phkg1, Phkg-1, Phkg 1, Phkg-1 Blocking Peptide, Phkg 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | REATLKEVDILQKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLT |
|---|---|
| Molecular Weight | 42 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Phkg1 is a catalytic subunit of phosphorylase kinase complex; It plays a role in glycogen metabolism. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product