Phkg1 Blocking Peptide (33R-7866)

A synthetic peptide for use as a blocking control in assays to test for specificity of Phkg1 antibody, catalog no. 70R-9422

Synonyms Phkg1 control peptide, Phkg1 antibody Blocking Peptide, Anti-Phkg1 Blocking Peptide, phosphorylase kinase, gamma 1 Blocking Peptide, Phkg Blocking Peptide, PHKIN01 Blocking Peptide, Phkg1 Blocking Peptide, Phkg1, Phkg-1, Phkg 1, Phkg-1 Blocking Peptide, Phkg 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues REATLKEVDILQKVSGHPNIIQLKDTYETNTFFFLVFDLMKRGELFDYLT
Molecular Weight 42 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Phkg1 is a catalytic subunit of phosphorylase kinase complex; It plays a role in glycogen metabolism.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors