PHKG2 antibody (70R-2669)
Rabbit polyclonal PHKG2 antibody
Overview
Overview
| Synonyms | Polyclonal PHKG2 antibody, Anti-PHKG2 antibody, PHKG-2, PHKG2, Phosphorylase Kinase Gamma 2 antibody, PHKG 2, PHKG 2 antibody, PHKG-2 antibody |
|---|---|
| Cross Reactivity | Human,Dog |
| Applications | IHC, WB |
| Immunogen | PHKG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV |
| Assay Information | PHKG2 Blocking Peptide, catalog no. 33R-2309, is also available for use as a blocking control in assays to test for specificity of this PHKG2 antibody |
Images
Immunohistochemical staining using PHKG2 antibody (70R-2669)
PHKG2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (Indicated with Arrows) in Human kidney. Magnification is at 400X
PHKG2 antibody
Immunohistochemical staining using PHKG2 antibody (70R-2669)
PHKG2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (Indicated with Arrows) in Human kidney. Magnification is at 400X
Western Blot analysis using PHKG2 antibody (70R-2669)
PHKG2 antibody (70R-2669) used at 0.5 ug/ml to detect target protein.
Specifications
| Host | Rabbit |
|---|---|
| Method of Purification | Affinity purified |
| Molecular Weight | 46 kDa (MW of target protein) |
| Form & Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PHKG2 antibody in PBS |
| Concentration | 1 mg/ml |
Usage & Assay Information
| Usage Recommendations | WB: 0.5 ug/ml; IHC: 4-8 ug/ml |
|---|
Storage & Safety
| Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Mutations in PHKG2 along with PHKA2 and PHKB, all three different genes of phosphorylase kinase (Phk) subunits, can give rise to glycogen storage disease of the liver. The autosomal-recessive, liver-specific variant of Phk deficiency is caused by mutations in the gene encoding the testis/liver isoform of the catalytic gamma subunit, PHKG2. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product
