PHYH Blocking Peptide (33R-9180)
A synthetic peptide for use as a blocking control in assays to test for specificity of PHYH antibody, catalog no. 70R-9423
Overview
Overview
| Synonyms | PHYH control peptide, PHYH antibody Blocking Peptide, Anti-PHYH Blocking Peptide, phytanoyl-CoA 2-hydroxylase Blocking Peptide, LN1 Blocking Peptide, LNAP1 Blocking Peptide, PAHX Blocking Peptide, PHYH1 Blocking Peptide, RD Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFR |
|---|---|
| Molecular Weight | 26 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. Mutations in this gene have been associated with Refsum disease (RD) and deficient protein activity has been associated with Zellweger syndrome and rhizomelic chondrodysplasia punctata. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product