PHYH Blocking Peptide (33R-9180)

A synthetic peptide for use as a blocking control in assays to test for specificity of PHYH antibody, catalog no. 70R-9423

Synonyms PHYH control peptide, PHYH antibody Blocking Peptide, Anti-PHYH Blocking Peptide, phytanoyl-CoA 2-hydroxylase Blocking Peptide, LN1 Blocking Peptide, LNAP1 Blocking Peptide, PAHX Blocking Peptide, PHYH1 Blocking Peptide, RD Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TLPEILKYVECFTGPNIMAMHTMLINKPPDSGKKTSRHPLHQDLHYFPFR
Molecular Weight 26 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the PhyH family and encodes a peroxisomal protein that is involved in the alpha-oxidation of 3-methyl branched fatty acids. Specifically, this protein converts phytanoyl-CoA to 2-hydroxyphytanoyl-CoA. Mutations in this gene have been associated with Refsum disease (RD) and deficient protein activity has been associated with Zellweger syndrome and rhizomelic chondrodysplasia punctata. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors