PIGF1 protein (30R-AP007)

Purified recombinant Human PIGF1 protein

Synonyms PIGF1, PIGF 1 protein, PIGF-1, Placenta Growth Factor-1 protein, PIGF-1 protein, PIGF 1, PGF protein, PIGF protein
Species Human
Protein Type Binding Protein
Applications User optimized

Specifications

Residues LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSE VEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYV ELTFSQHVRCECRPLREKMKPERCGDAVPRR
Expression System Sf-9 insect cells
Grade & Purity > 95% pure
Molecular Weight 19 kDa
Form & Buffer Lyophilized with carrier-protein (HSA) and can be reconstituted with 0.1 M acetic acid or PBS.

Storage & Safety

Storage Store at -20 deg C until reconstitution. Following reconstitution product may be stored at 4 deg C in the short term. For long term storage aliquot and freeze at -20 deg C. Avoid repeated freeze/thaw cycles.

General Information

Biological Significance Human Placenta Growth Factor-1 (PlGF-1), a 19 kDa protein consisting of 131 amino acid residues is produced as a homodimer. Human Placenta Growth Factor (PlGF) is a polypeptide growth factor and a member of the platelet-derived growth factor family but more related to vascular endothelial growth factor (VEGF). PlGF-1 acts only as a very weak mitogen for some endothelial cell types and as a potent chemoattractant for monocytes. The physiological function in vivo is still controversal. In several reports it was shown not to be a potent mitogen for endotehlial cells and not angiogenic in vivo by using different assays.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €598.77
Size: 20 ug
OR
Shipping
View Our Distributors