PIGF1 protein (30R-AP036)
Purified recombinant Human PIGF1 protein
Overview
Overview
| Synonyms | PGF protein, PIGF-1, PIGF 1, PIGF protein, PIGF 1 protein, PIGF1, Placenta Growth Factor-1 protein, PIGF-1 protein |
|---|---|
| Species | Human |
| Protein Type | Binding Protein |
| Applications | User optimized |
Specifications
| Residues | LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSE VEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYV ELTFSQHVRCECRPLREKMKPERCGDAVPRR |
|---|---|
| Expression System | Sf-9 insect cells |
| Grade & Purity | > 90% pure |
| Molecular Weight | 19 kDa |
| Form & Buffer | Lyophilized with carrier-protein (HSA) and can be reconstituted with 50 mM acetic acid or PBS. |
Storage & Safety
| Storage | Store at -20 deg C until reconstitution. Following reconstitution product may be stored at 4 deg C in the short term. For long term storage aliquot and freeze at -20 deg C. Avoid repeated freeze/thaw cycles. |
|---|
General Information
| Biological Significance | Human Placenta Growth Factor-1 (PlGF-1), a 19 kDa protein consisting of 131 amino acid residues is produced as a homodimer. Human Placenta Growth Factor (PlGF) is a polypeptide growth factor and a member of the platelet-derived growth factor family but more related to vascular endothelial growth factor (VEGF). PlGF-1 acts only as a very weak mitogen for some endothelial cell types and as a potent chemoattractant for monocytes. The physiological function in vivo is still controversal. In several reports it was shown not to be a potent mitogen for endotehlial cells and not angiogenic in vivo by using different assays. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product