PIGL antibody (70R-4483)

Rabbit polyclonal PIGL antibody raised against the N terminal of PIGL

Synonyms Polyclonal PIGL antibody, Anti-PIGL antibody, Phosphatidylinositol Glycan Anchor Biosynthesis Class L antibody
Specificity PIGL antibody was raised against the N terminal of PIGL
Cross Reactivity Human
Applications WB
Immunogen PIGL antibody was raised using the N terminal of PIGL corresponding to a region with amino acids MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHP
Assay Information PIGL Blocking Peptide, catalog no. 33R-5892, is also available for use as a blocking control in assays to test for specificity of this PIGL antibody


Western Blot analysis using PIGL antibody (70R-4483)

PIGL antibody (70R-4483) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIGL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PIGL antibody (70R-4483) | PIGL antibody (70R-4483) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors