PIGV antibody (70R-1879)

Rabbit polyclonal PIGV antibody raised against the N terminal of PIGV

Synonyms Polyclonal PIGV antibody, Anti-PIGV antibody, Phosphatidylinositol Glycan Anchor Biosynthesis Class V antibody, FLJ20477 antibody
Specificity PIGV antibody was raised against the N terminal of PIGV
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen PIGV antibody was raised using the N terminal of PIGV corresponding to a region with amino acids FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE
Assay Information PIGV Blocking Peptide, catalog no. 33R-3111, is also available for use as a blocking control in assays to test for specificity of this PIGV antibody

Images

Western Blot analysis using PIGV antibody (70R-1879)

PIGV antibody (70R-1879) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PIGV antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. The biosynthetic pathway of GPI is mediated by sequential addition of sugars and other components to phosphatidylinositol. PIGV adds the second mannose to the GPI core.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PIGV antibody (70R-1879) | PIGV antibody (70R-1879) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using PIGV antibody (70R-1879) | PIGV antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors