PIGZ antibody (70R-7100)

Rabbit polyclonal PIGZ antibody raised against the N terminal of PIGZ

Synonyms Polyclonal PIGZ antibody, Anti-PIGZ antibody, Phosphatidylinositol Glycan Anchor Biosynthesis Class Z antibody, MGC52163 antibody, FLJ12768 antibody, SMP3 antibody, GPI-MT-IV antibody
Specificity PIGZ antibody was raised against the N terminal of PIGZ
Cross Reactivity Human
Applications WB
Immunogen PIGZ antibody was raised using the N terminal of PIGZ corresponding to a region with amino acids VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY
Assay Information PIGZ Blocking Peptide, catalog no. 33R-9694, is also available for use as a blocking control in assays to test for specificity of this PIGZ antibody

Images

Western Blot analysis using PIGZ antibody (70R-7100)

PIGZ antibody (70R-7100) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIGZ antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. PIGZ is a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PIGZ antibody (70R-7100) | PIGZ antibody (70R-7100) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors