PIK3R3 antibody (70R-1640)

Rabbit polyclonal PIK3R3 antibody

Synonyms Polyclonal PIK3R3 antibody, Anti-PIK3R3 antibody, p55-GAMMA antibody, PIKR 3, PIKR 3 antibody, PIKR-3, PIK3R3, FLJ41892 antibody, Phosphoinositide-3-Kinase Regulatory Subunit 3 antibody, PIKR-3 antibody, DKFZp686P05226 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PIK3R3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNE
Assay Information PIK3R3 Blocking Peptide, catalog no. 33R-2832, is also available for use as a blocking control in assays to test for specificity of this PIK3R3 antibody

Images

Western Blot analysis using PIK3R3 antibody (70R-1640)

PIK3R3 antibody (70R-1640) used at 5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of PIK3R3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PIK3R3 binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PIK3R3 antibody (70R-1640) | PIK3R3 antibody (70R-1640) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors