PIK3R4 antibody (70R-5627)

Rabbit polyclonal PIK3R4 antibody raised against the N terminal of PIK3R4

Synonyms Polyclonal PIK3R4 antibody, Anti-PIK3R4 antibody, PIKR4-3 antibody, PIKR4 3 antibody, PIKR4-3, p150 antibody, PIK3R4, PIKR4 3, Phosphoinositide-3-Kinase Regulatory Subunit 4 antibody, VPS15 antibody, MGC102700 antibody
Specificity PIK3R4 antibody was raised against the N terminal of PIK3R4
Cross Reactivity Human
Applications WB
Immunogen PIK3R4 antibody was raised using the N terminal of PIK3R4 corresponding to a region with amino acids HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL
Assay Information PIK3R4 Blocking Peptide, catalog no. 33R-3710, is also available for use as a blocking control in assays to test for specificity of this PIK3R4 antibody

Images

Western Blot analysis using PIK3R4 antibody (70R-5627)

PIK3R4 antibody (70R-5627) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 153 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIK3R4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein can regulate subunit of the PI3K complex and may regulate membrane trafficking late in the endocytic pathway.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PIK3R4 antibody (70R-5627) | PIK3R4 antibody (70R-5627) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors