PIM1 antibody (70R-2101)

Rabbit polyclonal PIM1 antibody raised against the N terminal of PIM1

Synonyms Polyclonal PIM1 antibody, Anti-PIM1 antibody, PIM 1, PIM antibody, PIM-1 antibody, PIM1, PIM 1 antibody, Pim-1 Oncogene antibody, PIM-1
Specificity PIM1 antibody was raised against the N terminal of PIM1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen PIM1 antibody was raised using the N terminal of PIM1 corresponding to a region with amino acids MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG
Assay Information PIM1 Blocking Peptide, catalog no. 33R-6196, is also available for use as a blocking control in assays to test for specificity of this PIM1 antibody

Images

Western Blot analysis using PIM1 antibody (70R-2101)

PIM1 antibody (70R-2101) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PIM1 may affect the structure or silencing of chromatin by phosphorylating HP1 gamma/CBX3. Isoform 2 promotes the G1/S transition of the cell cycle via up-regulation of CDK2 activity and phosphorylation of CDKN1B.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PIM1 antibody (70R-2101) | PIM1 antibody (70R-2101) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors