PINX1 antibody (70R-2144)

Rabbit polyclonal PINX1 antibody raised against the N terminal of PINX1

Synonyms Polyclonal PINX1 antibody, Anti-PINX1 antibody, PINX-1 antibody, LPTS antibody, PINX1, PINX 1 antibody, PINX-1, LPTL antibody, MGC8850 antibody, Pin2-Interacting Protein 1 antibody, FLJ20565 antibody, PINX 1
Specificity PINX1 antibody was raised against the N terminal of PINX1
Cross Reactivity Human
Applications WB
Immunogen PINX1 antibody was raised using the N terminal of PINX1 corresponding to a region with amino acids EKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDF
Assay Information PINX1 Blocking Peptide, catalog no. 33R-2516, is also available for use as a blocking control in assays to test for specificity of this PINX1 antibody


Western Blot analysis using PINX1 antibody (70R-2144)

PINX1 antibody (70R-2144) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PINX1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PINX1 is a microtubule-binding protein essential for faithful chromosome segregation. PINX1 mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PINX1 antibody (70R-2144) | PINX1 antibody (70R-2144) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors