PIP3-E antibody (70R-3184)

Rabbit polyclonal PIP3-E antibody raised against the middle region of PIP3-E

Synonyms Polyclonal PIP3-E antibody, Anti-PIP3-E antibody, IPCEF1 antibody, PIP-E 3 antibody, PIP3-E, KIAA0403 antibody, PIP-E-3, PIP-E 3, PIP-E-3 antibody, Phosphoinositide-Binding Protein Pip3-E antibody, RP3-402L9.2 antibody
Specificity PIP3-E antibody was raised against the middle region of PIP3-E
Cross Reactivity Human
Applications WB
Immunogen PIP3-E antibody was raised using the middle region of PIP3-E corresponding to a region with amino acids IHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKE
Assay Information PIP3-E Blocking Peptide, catalog no. 33R-3982, is also available for use as a blocking control in assays to test for specificity of this PIP3-E antibody


Western Blot analysis using PIP3-E antibody (70R-3184)

PIP3-E antibody (70R-3184) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIP3-E antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance PIP3-E enhances the promotion of guanine-nucleotide exchange by PSCD2 on ARF6 in a concentration-dependent manner.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using PIP3-E antibody (70R-3184) | PIP3-E antibody (70R-3184) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors