PIP4K2A antibody (70R-2708)

Rabbit polyclonal PIP4K2A antibody raised against the N terminal of PIP4K2A

Synonyms Polyclonal PIP4K2A antibody, Anti-PIP4K2A antibody, PIP5KIIA antibody, Phosphatidylinositol-5-Phosphate 4-Kinase Type Ii Alpha antibody, FLJ13267 antibody, PIPK2A-4, PIPK2A 4, PIPK2A-4 antibody, PIPK2A 4 antibody, PIP5KII-alpha antibody, PIPK antibody, PIP4K2A, PIP5K2A antibody
Specificity PIP4K2A antibody was raised against the N terminal of PIP4K2A
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen PIP4K2A antibody was raised using the N terminal of PIP4K2A corresponding to a region with amino acids IDDQDFQNSLTRSAPLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMH
Assay Information PIP4K2A Blocking Peptide, catalog no. 33R-3909, is also available for use as a blocking control in assays to test for specificity of this PIP4K2A antibody

Images

Western Blot analysis using PIP4K2A antibody (70R-2708)

PIP4K2A antibody (70R-2708) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of PIP4K2A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Phosphatidylinositol-5,4-bisphosphate, the precursor to second messengers of the phosphoinositide signal transduction pathways, is thought to be involved in the regulation of secretion, cell proliferation, differentiation, and motility.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using PIP4K2A antibody (70R-2708) | PIP4K2A antibody (70R-2708) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors